Home / Health And Medical / Wellness Service / Serenity Wellness and Family Practice
Serenity Wellness and Family Practice
One of 33 wellness service listings in DeLand.
About Serenity Wellness and Family Practice
Serenity Wellness and Family Practice is a wellness service in the health and medical sector, based in DeLand, FL. Its recorded address is 890 N Boundary Ave Ste 101, 32720. The listing includes a telephone number, an official website. It is one of 33 wellness service listings tracked in DeLand; the nearest comparable listing is Zenith Wellness Studio, within walking distance in Deland. Serenity Wellness and Family Practice has 2 listed locations in total; this page covers the DeLand branch.
- Address
- 890 N Boundary Ave Ste 101, DeLand, FL, 32720
- Phone
- 3868734560
- Website
- serenitywellnessfamilypractice.com
Questions
Where is Serenity Wellness and Family Practice located?
890 N Boundary Ave Ste 101, DeLand, FL, 32720
How do I contact Serenity Wellness and Family Practice?
3868734560 · https://www.serenitywellnessfamilypractice.com/
What type of business is Serenity Wellness and Family Practice?
Serenity Wellness and Family Practice is a wellness service (health and medical) in DeLand.
Serenity Wellness and Family Practice branches
Serenity Wellness and Family Practice has 2 listed locations. This branch is in DeLand.
- DeLand32720-3173
Nearby wellness service
- Zenith Wellness StudioDeland0.0 km
- Claire Jeffries LMTDeLand0.3 km
- Katy Ray, LMTDeLand0.3 km
- Micah-Sue's MassageDeLand0.3 km
- Ideal Protein DelandDeLand0.4 km
- Beauty By ShiDeLand0.6 km
- Well-Watered Garden Massage And WellnessDeland0.8 km
- Metabolic Research CenterDeLand1.6 km
- Omisol Massage and SkinDeLand2.1 km
- Stetson Health ServiceDeland1.9 km
- Loosen UpDeLand2.1 km
- Angelique Chromy Med SpaDeLand2.1 km
- Amabella SpaDeLand2.2 km
- Amy-J's Faces & FeetDeLand2.2 km
- Noah CoreyDeLand2.4 km
Cite this page
“Serenity Wellness and Family Practice, DeLand — business.wiki, retrieved October 2026.” Facts on this page come from openly licensed data (Overture Maps Foundation) and are refreshed with each monthly release; sourcing is documented on the methodology page.